PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01698.1.p
Common NameEUGRSUZ_I01698, LOC104419178
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 275aa    MW: 31586 Da    PI: 4.601
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01698.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding476e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT eEd +l+  +   G ++W+tI++  g+ R++k+c++rw +yl
  Eucgr.I01698.1.p 14 RGPWTIEEDHKLISFIMNNGIHCWRTIPKLAGLLRCGKSCRLRWINYL 61
                      89******************************99************97 PP

2Myb_DNA-binding52.98.5e-1767110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg +T+ E++++++++ +lG++ W++Ia++++ gRt++++k++w++
  Eucgr.I01698.1.p  67 RGGFTEPEEDQIIQLHSRLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                       7889******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-22564IPR009057Homeodomain-like
PROSITE profilePS5129414.034961IPR017930Myb domain
SuperFamilySSF466892.25E-2911108IPR009057Homeodomain-like
SMARTSM007171.7E-81363IPR001005SANT/Myb domain
PfamPF002494.8E-131461IPR001005SANT/Myb domain
CDDcd001671.95E-61661No hitNo description
PROSITE profilePS5129425.37262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-2665117IPR009057Homeodomain-like
SMARTSM007176.0E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1567110IPR001005SANT/Myb domain
CDDcd001675.03E-1170110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRQPCCDKV GLKRGPWTIE EDHKLISFIM NNGIHCWRTI PKLAGLLRCG KSCRLRWINY  60
LRPDVKRGGF TEPEEDQIIQ LHSRLGNRWS KIASHFPGRT DNEIKNHWNT RIKKKLKLLG  120
LDPVTHQPIQ EDENNAQEIV NETDVDPNSI TEGSSHSDDK PTVLEADQDK VEAFSMEDEI  180
GLMTFEETAN LLENFEWLCG SFNEDQEGSR RNQQEMDTHV SQSSSSSVED SHLLQQHQQQ  240
QQQQWVDSGE SVVSWDGLDY LEQELFFLEN GELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-29121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C9e-29121162105C-Myb DNA-Binding Domain
1msf_C9e-29121162105C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01698.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029050.10.0PREDICTED: myb-related protein 315-like
TrEMBLA0A059AR570.0A0A059AR57_EUCGR; Uncharacterized protein
STRINGGLYMA16G06900.11e-109(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.16e-84myb domain protein 40